PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.275710.1 | ||||||||
Common Name | Csa_5G496470 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 132aa MW: 14659.9 Da PI: 9.3638 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 135 | 2.9e-42 | 15 | 114 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrr+C+++C+lapyfp ++p kfa+vh+++Ga nv+k+l++lpe++r da+sslvyeA+ar+rdP+yG++g i++lq+++++l+a+la Cucsa.275710.1 15 PCAACKILRRRCVDKCILAPYFPPTDPFKFAAVHRIYGAGNVIKFLQELPESQRADAASSLVYEANARIRDPIYGCTGSIFQLQNKVRELHAQLA 109 7********************************************************************************************** PP DUF260 96 llkee 100 ++k+e Cucsa.275710.1 110 VAKAE 114 99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.784 | 14 | 115 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.2E-41 | 15 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MQSSSPPPCT VVLSPCAACK ILRRRCVDKC ILAPYFPPTD PFKFAAVHRI YGAGNVIKFL 60 QELPESQRAD AASSLVYEAN ARIRDPIYGC TGSIFQLQNK VRELHAQLAV AKAEVHKMQQ 120 LQHPNLLALP RX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 8e-39 | 14 | 115 | 10 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 8e-39 | 14 | 115 | 10 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681891 | 3e-75 | LN681891.1 Cucumis melo genomic scaffold, anchoredscaffold00079. | |||
GenBank | LN713263 | 3e-75 | LN713263.1 Cucumis melo genomic chromosome, chr_9. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023551518.1 | 5e-72 | LOB domain-containing protein 1-like | ||||
Swissprot | Q9LQR0 | 3e-57 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
Swissprot | Q9SK08 | 8e-57 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | A0A0A0KU20 | 4e-90 | A0A0A0KU20_CUCSA; Uncharacterized protein | ||||
STRING | XP_004173617.1 | 2e-92 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1303 | 34 | 106 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 1e-59 | LOB domain-containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.275710.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|