![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.161230.1 | ||||||||
Common Name | Csa_2G373510 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 148aa MW: 16591.9 Da PI: 7.809 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 126.3 | 1.5e-39 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrr+C+++C+++pyfp+++p++fa+vh+++Gasnv k+l+++p + r +a+++l++eA++r++dP+yG+vg+i++lq +l+ ++++la Cucsa.161230.1 5 RCAACKYLRRRCSSNCIFSPYFPSNNPQRFAIVHRIYGASNVAKFLQQVPMDLRGEAAETLYFEAKCRIEDPIYGCVGIISQLQYELHVAETQLA 99 6********************************************************************************************** PP DUF260 96 llkee 100 ++++e Cucsa.161230.1 100 KTRAE 104 99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.5 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.9E-39 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MIPSRCAACK YLRRRCSSNC IFSPYFPSNN PQRFAIVHRI YGASNVAKFL QQVPMDLRGE 60 AAETLYFEAK CRIEDPIYGC VGIISQLQYE LHVAETQLAK TRAEIALLAS NRQQAQHEDF 120 PFDDPSSGPI FTGLSTPAHF SEQLFRA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-33 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-33 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 1e-106 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 1e-106 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023522202.1 | 8e-74 | LOB domain-containing protein 24-like | ||||
Swissprot | P59468 | 3e-52 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A0A0LLX6 | 1e-105 | A0A0A0LLX6_CUCSA; Uncharacterized protein | ||||
STRING | XP_004162991.1 | 1e-106 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3697 | 30 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 1e-54 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.161230.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|