![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.106970.1 | ||||||||
Common Name | Csa_4G050130, LOC101221558 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 201aa MW: 22446.2 Da PI: 7.8606 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.7 | 4.1e-32 | 121 | 179 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk s++prsYYrCt+++C+vkk+++r +dp++v++tYeg Hnh+ Cucsa.106970.1 121 LDDGYRWRKYGQKAVKHSNHPRSYYRCTHHTCNVKKQIQRHPKDPTIVVTTYEGIHNHP 179 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.8E-33 | 108 | 180 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.42E-28 | 116 | 180 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.392 | 116 | 181 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.6E-37 | 121 | 180 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.1E-25 | 122 | 179 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MGDDNINQMG STSSSSMMNN CEIIDWDGLF SSSCLSNNLE MVEKGICGSD QDDNNYYPMG 60 DNNNNVVIGG VKEGDIIIGG GHNNNNNNNN CKYKGKMVMG KRSTIASPRI AFQTKSVEDV 120 LDDGYRWRKY GQKAVKHSNH PRSYYRCTHH TCNVKKQIQR HPKDPTIVVT TYEGIHNHPS 180 EKLMETLTPL LKQLQFLSGI * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-24 | 111 | 178 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 6e-24 | 111 | 178 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00539 | DAP | Transfer from AT5G41570 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681873 | 1e-155 | LN681873.1 Cucumis melo genomic scaffold, anchoredscaffold00027. | |||
GenBank | LN713261 | 1e-155 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011653192.1 | 1e-148 | PREDICTED: probable WRKY transcription factor 24 | ||||
Swissprot | Q9FFS3 | 1e-53 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A0A0KZP6 | 1e-146 | A0A0A0KZP6_CUCSA; Uncharacterized protein | ||||
STRING | XP_004146569.1 | 1e-126 | (Cucumis sativus) | ||||
STRING | XP_004170512.1 | 1e-126 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3227 | 34 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 2e-55 | WRKY DNA-binding protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.106970.1 |
Entrez Gene | 101221558 |
Publications ? help Back to Top | |||
---|---|---|---|
|