PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

MIKC_MADS

Protein Properties

Length: 208aa MW: 23703.6 Da PI: 7.0871

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.061750.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	79.1	3.2e-25	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ + ifs +gklye + Cucsa.061750.1 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKLYELA 58 79*********************************************965 PP
2	K-box	46.7	1.4e-16	87	174	13	99
K-box 13 kaeslqqelakLkkeienLqreqRhllGedLes..LslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++ + ++e+ +Lk+eie L+ R+ lG + ++ ++l eL e+qLe + ++Rs+K+++++e+ie l+++e l +nk+L+ k+e Cucsa.061750.1 87 QTLEVKEEIIRLKQEIEVLKGL-RNALGGGGGEgiMTLDELDIFEKQLEIWICQVRSTKMKFMCEEIEALRNQEFILTAANKYLHDKME 174 556789************87.9998765543349***********************************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.9E-35	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	6.41E-28	1	76	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.787	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.24E-40	2	76	No hit	No description
PRINTS	PR00404	4.7E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.8E-22	10	56	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.7E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.7E-27	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.0E-16	86	173	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	10.211	88	179	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0048364	Biological Process	root development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 208 aa Download sequence Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLFIFSA HGKLYELATK 60 GTMQGLIERY MKHTNGNQPP DPPIHHQTLE VKEEIIRLKQ EIEVLKGLRN ALGGGGGEGI 120 MTLDELDIFE KQLEIWICQV RSTKMKFMCE EIEALRNQEF ILTAANKYLH DKMEAENISN 180 TTNMEPVNIT NCQYPLTIQD ELFQLCT*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-17	1	91	1	87	MEF2C
5f28_B	6e-17	1	91	1	87	MEF2C
5f28_C	6e-17	1	91	1	87	MEF2C
5f28_D	6e-17	1	91	1	87	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269\|PubMed:18203871}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin in root phloem. {ECO:0000269\|PubMed:18203871}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681889	4e-94	LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBank	LN713263	4e-94	LN713263.1 Cucumis melo genomic chromosome, chr_9.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011656111.1	1e-153	PREDICTED: agamous-like MADS-box protein AGL12
Swissprot	Q38841	4e-66	AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBL	A0A0A0KW77	1e-152	A0A0A0KW77_CUCSA; Uncharacterized protein
STRING	XP_008459723.1	1e-101	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF7566	31	44

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G71692.1	3e-64	AGAMOUS-like 12

Link Out ? help Back to Top
Phytozome	Cucsa.061750.1
Entrez Gene	105435626

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Pacheco-Escobedo MA, et al. Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm. Ann. Bot., 2018. [PMID:27358290] García-Cruz KV, et al. The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components. Ann. Bot., 2018. [PMID:27474508]