![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.048230.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 125aa MW: 13898 Da PI: 10.4683 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.3 | 1.1e-32 | 22 | 78 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+k ksrkpylheSRh hAlrR+Rg+gGrF Cucsa.048230.4 22 EEPVFVNAKQYHGILRRRQSRAKAESENKA-LKSRKPYLHESRHLHALRRARGCGGRF 78 69***************************9.9*************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 4.2E-35 | 20 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.843 | 21 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 9.8E-28 | 23 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 9.6E-24 | 24 | 46 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 26 | 46 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 9.6E-24 | 55 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MVHLQLMGIQ QAGVPLPTDA VEEPVFVNAK QYHGILRRRQ SRAKAESENK ALKSRKPYLH 60 ESRHLHALRR ARGCGGRFLK SNKNENHQNE VASAHLDNCK EIEVSIPASV VLALLHPWSI 120 LAAL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 5e-21 | 21 | 93 | 1 | 74 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681875 | 7e-85 | LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007. | |||
GenBank | LN713262 | 7e-85 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022926733.1 | 4e-76 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Refseq | XP_022926735.1 | 2e-76 | nuclear transcription factor Y subunit A-7-like isoform X3 | ||||
Refseq | XP_023518238.1 | 2e-76 | nuclear transcription factor Y subunit A-7-like isoform X1 | ||||
Swissprot | Q84JP1 | 2e-48 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A0A0KIV0 | 2e-61 | A0A0A0KIV0_CUCSA; Uncharacterized protein | ||||
STRING | XP_004134622.1 | 3e-62 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 7e-51 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.048230.4 |
Publications ? help Back to Top | |||
---|---|---|---|
|