PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

Dof

Protein Properties

Length: 174aa MW: 19419 Da PI: 8.8006

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.046960.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	122.7	1.2e-38	50	108	2	60
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvP+G+grr+ k Cucsa.046960.1 50 PEKIIPCPRCKSMDTKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPIGAGRRRAKP 108 68999**************************************************9885 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-28	49	107	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	1.1E-31	52	107	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.239	54	108	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	56	92	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 174 aa Download sequence Send to blast
MAEVHSSNTD GIKLFGTMIH LQTRKLKEEP EKGGAVAGGG EGDETEMKRP EKIIPCPRCK 60 SMDTKFCYFN NYNVNQPRHF CKGCQRYWTA GGALRNVPIG AGRRRAKPPP NCRTLSGELS 120 EDYGQYYDAA SGIIHQLELD TVEGWHLTVA EQDFTKVFPF KRRKIIGQHG QSS*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN684388	0.0	LN684388.1 Cucumis melo genomic scaffold, unassembled_sequence31902.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004134661.2	1e-129	PREDICTED: cyclic dof factor 4
Swissprot	O22967	1e-48	CDF4_ARATH; Cyclic dof factor 4
TrEMBL	A0A0A0KKD0	1e-128	A0A0A0KKD0_CUCSA; Uncharacterized protein
STRING	XP_004172169.1	1e-128	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6483	32	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29160.1	3e-48	Dof family protein

Link Out ? help Back to Top
Phytozome	Cucsa.046960.1
Entrez Gene	101215015

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]