PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa06g048430.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 181aa MW: 20101.3 Da PI: 9.231 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 33.4 | 9.8e-11 | 48 | 91 | 5 | 48 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 kr +r NR +A+rsR RK+++i eLe+ v +L+ae + L + Csa06g048430.1 48 KRVKRILANRQSAQRSRVRKLQYISELERCVTSLQAEVSVLSPR 91 8999********************************98877665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.2E-13 | 44 | 108 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.358 | 46 | 98 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.1E-12 | 48 | 99 | No hit | No description |
SuperFamily | SSF57959 | 7.39E-11 | 48 | 100 | No hit | No description |
Pfam | PF00170 | 3.2E-9 | 48 | 92 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14703 | 6.01E-20 | 49 | 99 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 51 | 66 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MTNNNNNNNS NNINNDEVQS QCKTEPDDGT ASTNNSGDSS GNRILDPKRV KRILANRQSA 60 QRSRVRKLQY ISELERCVTS LQAEVSVLSP RVAFLDHQRL LLNVDNSALK QRIAALSQDK 120 VFKDAHQEAL KREIERLRQV YNQQSLKTMD NANHSPATGA GATSAVDIMT SIEKEQLLNV 180 * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269|PubMed:17719007, ECO:0000269|PubMed:19449183}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa06g048430.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY074657 | 0.0 | AY074657.1 Arabidopsis thaliana At2g42380/MHK10.10 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010508583.1 | 1e-114 | PREDICTED: basic leucine zipper 34-like | ||||
Swissprot | F4IN23 | 1e-103 | BZP34_ARATH; Basic leucine zipper 34 | ||||
TrEMBL | D7LI53 | 1e-105 | D7LI53_ARALL; BZIP transcription factor family protein | ||||
STRING | XP_010508583.1 | 1e-113 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1753 | 27 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G42380.2 | 1e-105 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|