 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Ciclev10023399m |
Common Name | CICLE_v10023399mg |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
Family |
ZF-HD |
Protein Properties |
Length: 95aa MW: 10384.6 Da PI: 8.4985 |
Description |
ZF-HD family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Ciclev10023399m | genome | ICGC | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | ZF-HD_dimer | 96.9 | 1.6e-30 | 29 | 83 | 4 | 60 |
ZF-HD_dimer 4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
vrY eC+kNhAa++Gg+avDGC+Efm+s ge+ + al+CaACgCHRnFHRre+e+e
Ciclev10023399m 29 VRYAECQKNHAANIGGYAVDGCREFMAS-GEN-GTGALTCAACGCHRNFHRREEETE 83
89*************************9.555.5799****************9876 PP
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots, stems and flowers, present in seedlings and leaves, and weakly observed in inflorescence and siliques. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:18713354}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |