![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10022641m | ||||||||
Common Name | CICLE_v10022641mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 158aa MW: 17360.7 Da PI: 4.3597 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 77.2 | 2.4e-24 | 11 | 94 | 3 | 86 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 ++d+ lP a +++i+k++lPa+ ++++da++++ ec +efi +v+se+++ c re+++ti+++ +l al lGf +y+e++ + Ciclev10022641m 11 KEDASLPKATMTKIIKEMLPADVRVARDAQDLLIECCVEFINLVSSESNEVCSREDKRTIAPEHVLKALEVLGFGEYIEEVYAA 94 6899***************************************************************************98654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.6E-39 | 8 | 140 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.35E-35 | 12 | 141 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-21 | 14 | 79 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MEPMDIVGKS KEDASLPKAT MTKIIKEMLP ADVRVARDAQ DLLIECCVEF INLVSSESNE 60 VCSREDKRTI APEHVLKALE VLGFGEYIEE VYAAYEQHKL ETMQDSLKGG KWSNGAEMTE 120 EEAAAEQQRM FAEARARMNG GAAGPPKQPD INPSLES* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 1e-33 | 12 | 135 | 12 | 133 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ccl.20153 | 1e-157 | fruit| leaf |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006440888.1 | 1e-113 | protein Dr1 homolog isoform X1 | ||||
Refseq | XP_006494260.1 | 1e-113 | protein Dr1 homolog isoform X1 | ||||
Swissprot | P49592 | 1e-92 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | A0A067FDZ1 | 1e-112 | A0A067FDZ1_CITSI; Uncharacterized protein | ||||
TrEMBL | V4T1V8 | 1e-112 | V4T1V8_9ROSI; Uncharacterized protein | ||||
STRING | XP_006494260.1 | 1e-113 | (Citrus sinensis) | ||||
STRING | XP_006440888.1 | 1e-113 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3828 | 26 | 60 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.2 | 3e-75 | nuclear factor Y, subunit B13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10022641m |
Entrez Gene | 18050050 |
Publications ? help Back to Top | |||
---|---|---|---|
|