PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10018947m | ||||||||
Common Name | CARUB_v10018947mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 170aa MW: 19790.9 Da PI: 6.273 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 40 | 8.5e-13 | 77 | 127 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +++rr+ +NRe+ArrsR RK+ ++eL v L +eN L+++l++ +++ Carubv10018947m 77 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSET 127 79********************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 9.0E-14 | 73 | 137 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.588 | 75 | 126 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 4.2E-10 | 77 | 149 | No hit | No description |
SuperFamily | SSF57959 | 5.47E-12 | 77 | 126 | No hit | No description |
Pfam | PF00170 | 1.2E-10 | 77 | 127 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 1.69E-17 | 78 | 126 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 80 | 95 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MIPAEITGYF QYLSPEYNVI NMPTSPTSSL NYLNDMIINN NNSNYSSSSN SQELMISNNN 60 SASDEDHHQS IIILDERKQR RMLSNRESAR RSRMRKQRHL DELWSQVIRL RNENNCLIDK 120 LNRVSETQDC VLKENSKLKE EASDLRQLVC ELKSNKNNNN SFAREFEDN* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 89 | 96 | RRSRMRKQ |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00262 | DAP | Transfer from AT2G04038 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10018947m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493545 | 0.0 | AB493545.1 Arabidopsis thaliana At2g04038 gene for hypothetical protein, partial cds, clone: RAAt2g04038. | |||
GenBank | AC007178 | 0.0 | AC007178.6 Arabidopsis thaliana chromosome 2 clone F3L12 map mi320, complete sequence. | |||
GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006292701.1 | 1e-119 | basic leucine zipper 43 | ||||
TrEMBL | R0H8E4 | 1e-117 | R0H8E4_9BRAS; Uncharacterized protein | ||||
STRING | XP_006292701.1 | 1e-118 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2892 | 24 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G04038.1 | 6e-89 | basic leucine-zipper 48 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10018947m |
Entrez Gene | 17885085 |