PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.4609s0004.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 167aa MW: 19462.6 Da PI: 5.7575 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 40 | 8.3e-13 | 74 | 124 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +++rr+ +NRe+ArrsR RK+ ++eL v L +eN L+++l++ +++ Cagra.4609s0004.1.p 74 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSET 124 79********************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 9.0E-14 | 70 | 134 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.588 | 72 | 123 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.1E-10 | 74 | 124 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.4E-10 | 74 | 146 | No hit | No description |
SuperFamily | SSF57959 | 4.57E-12 | 74 | 123 | No hit | No description |
CDD | cd14702 | 2.11E-17 | 75 | 123 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 77 | 92 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MIPAEITGYF QYLSPEYNVI NMPSSPTSSL NYLNDMIINN NYSSSSNSQE LMISNNNSAS 60 DEDHHQSIII LDERKQRRML SNRESARRSR MRKQRHLDEL WSQVIRLRNE NNCLIDKLNR 120 VSETQDCVLK ENSKLKEEAS DLRQLVCELK SNKNNDNSFA REFEDN* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 86 | 93 | RRSRMRKQ |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00262 | DAP | Transfer from AT2G04038 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.4609s0004.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493545 | 0.0 | AB493545.1 Arabidopsis thaliana At2g04038 gene for hypothetical protein, partial cds, clone: RAAt2g04038. | |||
GenBank | AC007178 | 0.0 | AC007178.6 Arabidopsis thaliana chromosome 2 clone F3L12 map mi320, complete sequence. | |||
GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006292701.1 | 6e-99 | basic leucine zipper 43 | ||||
TrEMBL | R0H8E4 | 1e-97 | R0H8E4_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.4609s0004.1.p | 1e-116 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2892 | 24 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G04038.1 | 2e-89 | basic leucine-zipper 48 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.4609s0004.1.p |