PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.1508s0081.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 257aa MW: 29931.4 Da PI: 9.2419 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 78.3 | 5.6e-25 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ ++rqvtf+kRr+ ++KKA+ELSvLCd+ +iifs +++ly+++s Cagra.1508s0081.1.p 9 KRIEDRIRRQVTFAKRRKSLMKKAHELSVLCDVHLGLIIFSYSNRLYDFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 44.3 | 7.6e-16 | 93 | 165 | 13 | 85 |
K-box 13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 + +++ + + + +eienL+ ++ + G +L+ L++ +L + e +Le+sl+++R++K e++ +qi++l+ k k Cagra.1508s0081.1.p 93 QCSNCAKTKETMMREIENLKINLQLYDGHGLNLLTYDDLLRFELHLESSLQHVRARKCEFMQQQINKLKGKAK 165 5566777788999********************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 26.338 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.9E-30 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.26E-36 | 2 | 80 | No hit | No description |
SuperFamily | SSF55455 | 1.03E-25 | 3 | 85 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.9E-23 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.9E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.9E-23 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.9E-23 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.547 | 94 | 207 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 8.0E-11 | 97 | 165 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0030308 | Biological Process | negative regulation of cell growth | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0048530 | Biological Process | fruit morphogenesis | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 257 aa Download sequence Send to blast |
MRKGKVVIKR IEDRIRRQVT FAKRRKSLMK KAHELSVLCD VHLGLIIFSY SNRLYDFCSN 60 TTSMENLIMR YQKEKEAGHT HTSADHSFHP ADQCSNCAKT KETMMREIEN LKINLQLYDG 120 HGLNLLTYDD LLRFELHLES SLQHVRARKC EFMQQQINKL KGKAKCTLYI SVFNTKLQQG 180 GSSWEQLMWQ AERQMMTTCQ IQDNDDVTRR QVKKEFLLFD REEEEHHQLI IGALQLVQLP 240 QPSPQPARNQ GPLSGP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_R | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_S | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
5f28_A | 8e-17 | 1 | 85 | 1 | 83 | MEF2C |
5f28_B | 8e-17 | 1 | 85 | 1 | 83 | MEF2C |
5f28_C | 8e-17 | 1 | 85 | 1 | 83 | MEF2C |
5f28_D | 8e-17 | 1 | 85 | 1 | 83 | MEF2C |
6c9l_A | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_B | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_C | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_D | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_E | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_F | 7e-17 | 1 | 85 | 1 | 83 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091, ECO:0000269|PubMed:27233529}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00172 | DAP | Transfer from AT1G31140 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.1508s0081.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006306362.2 | 1e-177 | agamous-like MADS-box protein AGL63 | ||||
Swissprot | Q9SA07 | 7e-99 | AGL63_ARATH; Agamous-like MADS-box protein AGL63 | ||||
TrEMBL | A0A2H4FR43 | 1e-176 | A0A2H4FR43_9BRAS; MADS-box transcription factor AGL63 | ||||
STRING | Cagra.1508s0081.1.p | 0.0 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16860 | 9 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31140.2 | 1e-101 | GORDITA |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.1508s0081.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|