PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.1365s0021.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 137aa MW: 16191.2 Da PI: 6.7193 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 28.7 | 2.9e-09 | 32 | 88 | 4 | 60 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 kr rr+ NRe+ArrsR k+++e+L++ v++ a N+ L ++ +l +++ + Cagra.1365s0021.1.p 32 EKRLRRMTCNRESARRSRMQGKMKMERLKTQVEQVMASNQFLSDKYVSLLELSHQIL 88 59**************************************99998877777766655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.3E-9 | 28 | 81 | No hit | No description |
SMART | SM00338 | 2.5E-4 | 29 | 93 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 1.1E-10 | 30 | 80 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.531 | 31 | 80 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.31E-7 | 33 | 82 | No hit | No description |
CDD | cd14702 | 7.21E-15 | 34 | 85 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MYLQNPHDED FFHVHDHHVG NHDQPSVVTD QEKRLRRMTC NRESARRSRM QGKMKMERLK 60 TQVEQVMASN QFLSDKYVSL LELSHQILLE NSQLKKALSS FQEYYTTLCY GKRDDDHMLA 120 NINDFDLNLQ SLDQPY* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.1365s0021.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010491438.1 | 2e-46 | PREDICTED: bZIP transcription factor 2 | ||||
TrEMBL | R0FLV4 | 5e-93 | R0FLV4_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.1365s0021.1.p | 1e-97 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM17031 | 8 | 11 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08141.1 | 1e-35 | basic leucine-zipper 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.1365s0021.1.p |