PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA12g10990 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 162aa MW: 17920.5 Da PI: 6.267 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171 | 1.3e-53 | 26 | 118 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 req+r+lPian++rimkk+lPan+ki+kd+k+tvqecvsefisf+tseasdkcq+ekrktingddll alatlGfedy+eplkvyl++yre+ CA12g10990 26 REQERYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLSALATLGFEDYIEPLKVYLTRYREVT 118 89*****************************************************************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.7E-50 | 22 | 119 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.43E-37 | 28 | 118 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.7E-27 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.5E-20 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.5E-20 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 4.5E-20 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MAEPASSGGG GSHESGGDPS PQSNLREQER YLPIANIGRI MKKALPANGK IAKDSKDTVQ 60 ECVSEFISFI TSEASDKCQK EKRKTINGDD LLSALATLGF EDYIEPLKVY LTRYREVTAV 120 SISLMFLGLV SHRTALFSQF HVLLGFLIIW FARELIREYM D* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 4e-45 | 24 | 116 | 1 | 93 | NF-YB |
4awl_B | 3e-45 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-45 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4g91_B | 3e-45 | 25 | 116 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-45 | 25 | 116 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CU457806 | 4e-84 | CU457806.5 S.lycopersicum DNA sequence from clone SL_MboI-28J22 on chromosome 4, complete sequence. | |||
GenBank | HG975443 | 4e-84 | HG975443.1 Solanum pennellii chromosome ch04, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016550674.1 | 1e-81 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
Refseq | XP_016550675.1 | 1e-81 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
Swissprot | Q8VYK4 | 6e-62 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A2G2Y7K5 | 1e-116 | A0A2G2Y7K5_CAPAN; Nuclear transcription factor Y subunit B-1 | ||||
TrEMBL | A0A2G3B2L2 | 1e-116 | A0A2G3B2L2_CAPCH; Nuclear transcription factor Y subunit B-1 | ||||
STRING | PGSC0003DMT400004366 | 1e-69 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.5 | 4e-59 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|