PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA07g17550 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 112aa MW: 13115 Da PI: 7.8723 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 75.8 | 6.9e-24 | 53 | 101 | 2 | 50 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 Cqve+C +dl ak+y++rhkvC+ h+kap vl++gl++rfCqqCsr+ CA07g17550 53 CQVEKCGVDLDGAKKYYKRHKVCQLHAKAPIVLLAGLRHRFCQQCSRYT 101 ***********************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 4.7E-22 | 48 | 100 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 18.204 | 50 | 111 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.66E-22 | 51 | 102 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 8.6E-19 | 53 | 100 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MDFVEEDNEF EEEDEEEDET VLIGKNSYLK RKKLNLDKKK GEKSDSMQVK QYCQVEKCGV 60 DLDGAKKYYK RHKVCQLHAK APIVLLAGLR HRFCQQCSRY TLNKTMSSHY F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 9e-16 | 51 | 100 | 9 | 58 | squamosa promoter binding protein-like 4 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016579534.1 | 3e-67 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
TrEMBL | A0A2G2Z507 | 5e-76 | A0A2G2Z507_CAPAN; Squamosa promoter-binding-like protein 3 | ||||
STRING | XP_009788885.1 | 6e-29 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 7e-20 | squamosa promoter binding protein-like 3 |