PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA02g04730 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 112aa MW: 12423.9 Da PI: 10.5649 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 106.5 | 2.3e-33 | 16 | 72 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 dep++VNaKQy++Il+RRq+Rak+e+ekkl k+rkpylheSRh hAl+R+Rg+gGrF CA02g04730 16 DEPVFVNAKQYHGILRRRQSRAKAESEKKL-LKARKPYLHESRHLHALKRARGCGGRF 72 79****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 5.1E-36 | 14 | 75 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.561 | 15 | 75 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 8.2E-28 | 17 | 72 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.3E-23 | 18 | 40 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 20 | 40 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.3E-23 | 49 | 72 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MGIQQAGVPL PSDAIDEPVF VNAKQYHGIL RRRQSRAKAE SEKKLLKARK PYLHESRHLH 60 ALKRARGCGG RFLTAKKTDN QQKQDESGDK SQVNTNLESG KDRIASSEND S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 3e-24 | 15 | 85 | 1 | 71 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT013370 | 1e-148 | BT013370.1 Lycopersicon esculentum clone 135390R, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016559376.1 | 3e-77 | PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_016559377.1 | 3e-77 | PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_016559378.1 | 3e-77 | PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_016559379.1 | 3e-77 | PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_016559380.1 | 3e-77 | PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Refseq | XP_016559381.1 | 3e-77 | PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1 | ||||
Swissprot | Q84JP1 | 3e-47 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A1U8FJF9 | 8e-76 | A0A1U8FJF9_CAPAN; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A2G3A6S1 | 8e-76 | A0A2G3A6S1_CAPAN; nuclear transcription factor Y subunit A-7 isoform X1 | ||||
STRING | Solyc02g069860.2.1 | 1e-72 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6650 | 23 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 9e-41 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|