PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g35590.1.p
Common NameBRADI_4g35590, CBF3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family ERF
Protein Properties Length: 251aa    MW: 26986.1 Da    PI: 4.7107
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g35590.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP256.57e-184699156
               AP2  1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
                      + y+GVr + + grWv+e+r+p +    kr +lg++ tae Aa+a++aa+++l+g+
  Bradi4g35590.1.p 46 PVYRGVRHRGNAGRWVCEVRVPGT--SGKRLWLGTHLTAESAARAHDAAMLALHGP 99
                      68*******************944..34**************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008478.5E-124698IPR001471AP2/ERF domain
PROSITE profilePS5103220.50847111IPR001471AP2/ERF domain
SuperFamilySSF541713.53E-1647112IPR016177DNA-binding domain
SMARTSM003802.0E-1647117IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.101.4E-2447113IPR001471AP2/ERF domain
CDDcd000181.09E-2048113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDMDGSDQQI TSPSSSSSHD QYGVVWSPPP PKRPAGRTKF KETRHPVYRG VRHRGNAGRW  60
VCEVRVPGTS GKRLWLGTHL TAESAARAHD AAMLALHGPS AAAAARLLNF PDSAWLLAVT  120
PSALADHDEI QRVAIAAVVD FQRREAATVQ VVNEPPINPA FAPLPPDNAV PWASSQPSAT  180
TGMFGEPVAM DSNMFELDMT SEMDVGRYYA DLAEGLLMEP PQPAPDTGAC WESGDDGDDA  240
TLWSYRNDLP *
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates high salinity- and dehydration-inducible transcription. Confers resistance to high salt, cold and drought stress (By similarity). {ECO:0000250}.
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates high salinity- and dehydration-inducible transcription. Confers resistance to high salt, cold and drought stress. {ECO:0000269|PubMed:12609047, ECO:0000269|PubMed:16284406}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g35590.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high-salt and cold stress. {ECO:0000269|PubMed:12609047}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ1804700.0JQ180470.1 Brachypodium distachyon CBF1 (CBF1), CBF2 (CBF2), CBF3 (CBF3), and CBF4 (CBF4) genes, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576749.10.0dehydration-responsive element-binding protein 1H
SwissprotA2Z3898e-55DRE1A_ORYSI; Dehydration-responsive element-binding protein 1A
SwissprotQ64MA11e-54DRE1A_ORYSJ; Dehydration-responsive element-binding protein 1A
TrEMBLH9C1H20.0H9C1H2_BRADI; CBF3
STRINGBRADI4G35590.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19636261
Representative plantOGRP6456520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25470.15e-24C-repeat/DRE binding factor 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Oh SJ,Kwon CW,Choi DW,Song SI,Kim JK
    Expression of barley HvCBF4 enhances tolerance to abiotic stress in transgenic rice.
    Plant Biotechnol. J., 2007. 5(5): p. 646-56
    [PMID:17614953]
  3. Xiao BZ, et al.
    Evaluation of seven function-known candidate genes for their effects on improving drought resistance of transgenic rice under field conditions.
    Mol Plant, 2009. 2(1): p. 73-83
    [PMID:19529831]
  4. Mito T,Seki M,Shinozaki K,Ohme-Takagi M,Matsui K
    Generation of chimeric repressors that confer salt tolerance in Arabidopsis and rice.
    Plant Biotechnol. J., 2011. 9(7): p. 736-46
    [PMID:21114612]
  5. Sun H, et al.
    ENAC1, a NAC transcription factor, is an early and transient response regulator induced by abiotic stress in rice (Oryza sativa L.).
    Mol. Biotechnol., 2012. 52(2): p. 101-10
    [PMID:22161313]
  6. Li C, et al.
    Comparative analyses reveal potential uses of Brachypodium distachyon as a model for cold stress responses in temperate grasses.
    BMC Plant Biol., 2012. 12: p. 65
    [PMID:22569006]
  7. Huang J, et al.
    A TFIIIA-type zinc finger protein confers multiple abiotic stress tolerances in transgenic rice (Oryza sativa L.).
    Plant Mol. Biol., 2012. 80(3): p. 337-50
    [PMID:22930448]
  8. Lourenço T, et al.
    Isolation and characterization of rice (Oryza sativa L.) E3-ubiquitin ligase OsHOS1 gene in the modulation of cold stress response.
    Plant Mol. Biol., 2013. 83(4-5): p. 351-63
    [PMID:23780733]
  9. Chen X, et al.
    The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway.
    Plant Cell Physiol., 2014. 55(3): p. 604-19
    [PMID:24399239]
  10. Wang ST, et al.
    MicroRNA319 positively regulates cold tolerance by targeting OsPCF6 and OsTCP21 in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(3): p. e91357
    [PMID:24667308]
  11. Chen M,Zhao Y,Zhuo C,Lu S,Guo Z
    Overexpression of a NF-YC transcription factor from bermudagrass confers tolerance to drought and salinity in transgenic rice.
    Plant Biotechnol. J., 2015. 13(4): p. 482-91
    [PMID:25283804]
  12. Paul S,Gayen D,Datta SK,Datta K
    Dissecting root proteome of transgenic rice cultivars unravels metabolic alterations and accumulation of novel stress responsive proteins under drought stress.
    Plant Sci., 2015. 234: p. 133-43
    [PMID:25804816]
  13. Challam C,Ghosh T,Rai M,Tyagi W
    Allele mining across DREB1A and DREB1B in diverse rice genotypes suggest a highly conserved pathway inducible by low temperature.
    J. Genet., 2015. 94(2): p. 231-8
    [PMID:26174670]
  14. Kan CC,Chung TY,Juo YA,Hsieh MH
    Glutamine rapidly induces the expression of key transcription factor genes involved in nitrogen and stress responses in rice roots.
    BMC Genomics, 2015. 16(1): p. 731
    [PMID:26407850]
  15. Min HJ,Jung YJ,Kang BG,Kim WT
    CaPUB1, a Hot Pepper U-box E3 Ubiquitin Ligase, Confers Enhanced Cold Stress Tolerance and Decreased Drought Stress Tolerance in Transgenic Rice (Oryza sativa L.).
    Mol. Cells, 2016. 39(3): p. 250-7
    [PMID:26674966]
  16. Kakar KU, et al.
    A consortium of rhizobacterial strains and biochemical growth elicitors improve cold and drought stress tolerance in rice (Oryza sativa L.).
    Plant Biol (Stuttg), 2016. 18(3): p. 471-83
    [PMID:26681628]
  17. Huo C, et al.
    Comparative Study of Early Cold-Regulated Proteins by Two-Dimensional Difference Gel Electrophoresis Reveals a Key Role for Phospholipase Dα1 in Mediating Cold Acclimation Signaling Pathway in Rice.
    Mol. Cell Proteomics, 2016. 15(4): p. 1397-411
    [PMID:26747563]
  18. Dou M,Cheng S,Zhao B,Xuan Y,Shao M
    The Indeterminate Domain Protein ROC1 Regulates Chilling Tolerance via Activation of DREB1B/CBF1 in Rice.
    Int J Mol Sci, 2016. 17(3): p. 233
    [PMID:26927068]
  19. Kudo M, et al.
    Double overexpression of DREB and PIF transcription factors improves drought stress tolerance and cell elongation in transgenic plants.
    Plant Biotechnol. J., 2017. 15(4): p. 458-471
    [PMID:27683092]
  20. He X, et al.
    A rice jacalin-related mannose-binding lectin gene, OsJRL, enhances Escherichia coli viability under high salinity stress and improves salinity tolerance of rice.
    Plant Biol (Stuttg), 2017. 19(2): p. 257-267
    [PMID:27718311]