PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.9736s0002.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 199aa MW: 22624.2 Da PI: 10.2317 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.2 | 2.9e-16 | 28 | 75 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ede+l+ +v++ G g+W+++ + g+ R++k+c++rw ++l Araha.9736s0002.1.p 28 KGPWTAAEDEILAAYVRENGEGNWNAVQKNTGLARCGKSCRLRWANHL 75 79******************************************9996 PP | |||||||
2 | Myb_DNA-binding | 48.5 | 2.1e-15 | 81 | 124 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g++T +E+ l++++++qlG++ W++ a+ ++ gRt++++k++w++ Araha.9736s0002.1.p 81 KGSFTGDEERLIIQLHAQLGNK-WARMAAQLP-GRTDNEIKNYWNT 124 799*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.317 | 23 | 75 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-12 | 27 | 77 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.26E-29 | 27 | 122 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.2E-15 | 28 | 75 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-22 | 29 | 82 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.68E-10 | 30 | 75 | No hit | No description |
PROSITE profile | PS51294 | 24.478 | 76 | 130 | IPR017930 | Myb domain |
SMART | SM00717 | 2.5E-15 | 80 | 128 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.0E-14 | 81 | 124 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.58E-11 | 83 | 126 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.0E-25 | 83 | 128 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009860 | Biological Process | pollen tube growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0090406 | Cellular Component | pollen tube | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MILYGGGGAG KDGGSTNHLS DGGVILKKGP WTAAEDEILA AYVRENGEGN WNAVQKNTGL 60 ARCGKSCRLR WANHLRPNLK KGSFTGDEER LIIQLHAQLG NKWARMAAQL PGRTDNEIKN 120 YWNTRLKRLQ RQGLPLYPPD IIPNHQLHPH PQHHHQQQQQ HNHHHHHHHQ QQQHHHQQMY 180 FQPQSSQPNT PSSSPLPSP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 5e-29 | 25 | 128 | 1 | 103 | C-Myb DNA-Binding Domain |
1msf_C | 5e-29 | 25 | 128 | 1 | 103 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.9736s0002.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269|PubMed:19714218}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF371979 | 0.0 | AF371979.1 Arabidopsis thaliana putative transcription factor MYB120 (MYB120) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013714707.1 | 1e-96 | transcription factor MYB120-like | ||||
Refseq | XP_020883573.1 | 2e-96 | transcription factor MYB120 | ||||
Swissprot | Q94FL7 | 2e-94 | MY120_ARATH; Transcription factor MYB120 | ||||
TrEMBL | A0A3P6ANN2 | 2e-95 | A0A3P6ANN2_BRACM; Uncharacterized protein | ||||
STRING | Bra035547.1-P | 9e-95 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9939 | 19 | 34 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G55020.1 | 5e-93 | myb domain protein 120 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.9736s0002.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|