PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn391001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 73aa MW: 7994.2 Da PI: 9.341 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 27.6 | 9e-09 | 1 | 24 | 1 | 24 |
YABBY 1 advfssseqvCyvqCnfCntilav 24 +d++ +eq+Cyv+CnfCnt+la Achn391001 1 MDLVPPPEQLCYVRCNFCNTVLAG 24 578899****************85 PP | |||||||
2 | YABBY | 31.7 | 5e-10 | 34 | 72 | 96 | 134 |
YABBY 96 vsseklsenedeevprvppvirPPekrqrvPsaynrfik 134 ss++ s++++ +p++ v++PPek+ r Psayn+f+k Achn391001 34 SSSSSSSTSNEPMSPKASFVVKPPEKKHRLPSAYNQFMK 72 2333336777888899999******************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.1E-5 | 6 | 24 | IPR006780 | YABBY protein |
Pfam | PF04690 | 7.0E-8 | 36 | 72 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
MDLVPPPEQL CYVRCNFCNT VLAGFVNEIK KGQSSSSSSS TSNEPMSPKA SFVVKPPEKK 60 HRLPSAYNQF MK* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019460407.1 | 1e-24 | PREDICTED: protein CRABS CLAW isoform X1 | ||||
Refseq | XP_019460408.1 | 9e-25 | PREDICTED: protein CRABS CLAW isoform X2 | ||||
TrEMBL | A0A2R6QD86 | 2e-27 | A0A2R6QD86_ACTCH; Protein DROOPING LEAF like | ||||
STRING | XP_002512055.1 | 7e-23 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5210 | 23 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69180.1 | 2e-07 | YABBY family protein |