Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 162.7 | 1.3e-50 | 13 | 141 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96
lp+GfrF+Ptdeelv +yL+ k++g+++++ +vi+e+di+k+ePwdLp + vk++++ew fF++ d+ky++g+r nrat +gyWkatgkd++++s k
AT5G24590.2 13 LPVGFRFSPTDEELVRYYLRLKINGHDNDV-RVIREIDICKWEPWDLPdfSVVKTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGK 109
79*************************999.99***************6447888999**************************************99 PP
NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128
++ +g+k+tLvfy+grapkg++t W+mheyr+
AT5G24590.2 110 TKIIGVKRTLVFYTGRAPKGTRTCWIMHEYRA 141
99****************************96 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1ut4_A | 6e-47 | 3 | 165 | 7 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-47 | 3 | 165 | 7 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-47 | 3 | 165 | 7 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-47 | 3 | 165 | 7 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-47 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swm_B | 8e-47 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swm_C | 8e-47 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swm_D | 8e-47 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swp_A | 8e-47 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swp_B | 8e-47 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swp_C | 8e-47 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
3swp_D | 8e-47 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
4dul_A | 6e-47 | 3 | 165 | 7 | 166 | NAC domain-containing protein 19 |
4dul_B | 6e-47 | 3 | 165 | 7 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Publications
? help Back to Top |
- Ren T,Qu F,Morris TJ
HRT gene function requires interaction between a NAC protein and viral capsid protein to confer resistance to turnip crinkle virus. Plant Cell, 2000. 12(10): p. 1917-26 [PMID:11041886] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Ooka H, et al.
Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] - Ernst HA,Olsen AN,Larsen S,Lo Leggio L
Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors. EMBO Rep., 2004. 5(3): p. 297-303 [PMID:15083810] - Ren T,Qu F,Morris TJ
The nuclear localization of the Arabidopsis transcription factor TIP is blocked by its interaction with the coat protein of Turnip crinkle virus. Virology, 2005. 331(2): p. 316-24 [PMID:15629774] - Lee BH,Henderson DA,Zhu JK
The Arabidopsis cold-responsive transcriptome and its regulation by ICE1. Plant Cell, 2005. 17(11): p. 3155-75 [PMID:16214899] - Suzuki N, et al.
Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c. Plant Physiol., 2005. 139(3): p. 1313-22 [PMID:16244138] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Truman W,de Zabala MT,Grant M
Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance. Plant J., 2006. 46(1): p. 14-33 [PMID:16553893] - Ma S,Bohnert HJ
Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression. Genome Biol., 2007. 8(4): p. R49 [PMID:17408486] - Huang D,Wu W,Abrams SR,Cutler AJ
The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] - Wang Y, et al.
Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] - Jeong RD,Chandra-Shekara AC,Kachroo A,Klessig DF,Kachroo P
HRT-mediated hypersensitive response and resistance to Turnip crinkle virus in Arabidopsis does not require the function of TIP, the presumed guardee protein. Mol. Plant Microbe Interact., 2008. 21(10): p. 1316-24 [PMID:18785827] - Kim MJ,Shin R,Schachtman DP
A nuclear factor regulates abscisic acid responses in Arabidopsis. Plant Physiol., 2009. 151(3): p. 1433-45 [PMID:19759343] - Gaudinier A, et al.
Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] - Donze T,Qu F,Twigg P,Morris TJ
Turnip crinkle virus coat protein inhibits the basal immune response to virus invasion in Arabidopsis by binding to the NAC transcription factor TIP. Virology, 2014. 449: p. 207-14 [PMID:24418554] - Ben Daniel BH, et al.
Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens. Physiol Plant, 2016. 157(4): p. 422-41 [PMID:26923089] - Li Y, et al.
The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains. Virus Res., 2016. 222: p. 94-105 [PMID:27288723]
|