PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT4G14540.1

Common Name

dl3310w, FCAALL.252, HAP3C, NFYB3, NF-YB3

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NF-YB

Protein Properties

Length: 161aa MW: 17186 Da PI: 6.1171

Description

nuclear factor Y, subunit B3

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G14540.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	188.7	4e-59	20	115	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+kyre+egek AT4G14540.1 20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQKYREVEGEK 115 89********************************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	4.9E-56	15	126	IPR009072	Histone-fold
SuperFamily	SSF47113	6.68E-42	22	126	IPR009072	Histone-fold
Pfam	PF00808	3.6E-28	25	89	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	5.4E-22	53	71	No hit	No description
PROSITE pattern	PS00685	0	56	72	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	5.4E-22	72	90	No hit	No description
PRINTS	PR00615	5.4E-22	91	109	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
MADSDNDSGG HKDGGNASTR EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF 60 ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYVEP LKVYLQKYRE VEGEKTTTAG 120 RQGDKEGGGG GGGAGSGSGG APMYGGGMVT TMGHQFSHHF S

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5g49_A	1e-50	14	110	1	97	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.33269	0.0	flower\| vegetative tissue

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	245592_at	0.0
Expression Atlas	AT4G14540	-
AtGenExpress	AT4G14540	-
ATTED-II	AT4G14540	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Function -- GeneRIF ? help Back to Top
The abi4, cbfA and cbp mutants showed weaker drought-tolerance after a herbicide norflurazon treatment, which indicated the physiological role of these key transcription factors. [PMID: 23832569]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G14540.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G12840, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G07980, AT1G08970, AT1G30500, AT1G54830, AT1G56170, AT1G72830
IntAct	Search O23310

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G14540

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117818	0.0	AK117818.1 Arabidopsis thaliana At4g14540 mRNA for putative CCAAT-binding transcription factor subunit A(CBF-A), complete cds, clone: RAFL18-01-N02.
GenBank	AL161539	0.0	AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBank	BT003684	0.0	BT003684.1 Arabidopsis thaliana At4g14540 mRNA, complete cds.
GenBank	CP002687	0.0	CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBank	Z97336	0.0	Z97336.1 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 1.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_193190.1	1e-117	nuclear factor Y, subunit B3
Swissprot	O23310	1e-118	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A178V2P3	1e-115	A0A178V2P3_ARATH; NF-YB3
STRING	AT4G14540.1	1e-116	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229
Representative plant	OGRP168	17	170

Link Out ? help Back to Top
Phytozome	AT4G14540.1
Entrez Gene	827101
iHOP	AT4G14540
wikigenes	AT4G14540

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Gusmaroli G,Tonelli C,Mantovani R Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana. Gene, 2001. 264(2): p. 173-85 [PMID:11250072] Gusmaroli G,Tonelli C,Mantovani R Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits. Gene, 2002. 283(1-2): p. 41-8 [PMID:11867211] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Che P,Gingerich DJ,Lall S,Howell SH Global and hormone-induced gene expression changes during shoot development in Arabidopsis. Plant Cell, 2002. 14(11): p. 2771-85 [PMID:12417700] Kwong RW, et al. LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development. Plant Cell, 2003. 15(1): p. 5-18 [PMID:12509518] Lee H,Fischer RL,Goldberg RB,Harada JJ Arabidopsis LEAFY COTYLEDON1 represents a functionally specialized subunit of the CCAAT binding transcription factor. Proc. Natl. Acad. Sci. U.S.A., 2003. 100(4): p. 2152-6 [PMID:12578989] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Hoth S, et al. Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana. FEBS Lett., 2003. 554(3): p. 373-80 [PMID:14623097] Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] Wenkel S, et al. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell, 2006. 18(11): p. 2971-84 [PMID:17138697] Osuna D, et al. Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings. Plant J., 2007. 49(3): p. 463-91 [PMID:17217462] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Liu JX,Howell SH bZIP28 and NF-Y transcription factors are activated by ER stress and assemble into a transcriptional complex to regulate stress response genes in Arabidopsis. Plant Cell, 2010. 22(3): p. 782-96 [PMID:20207753] Kumimoto RW,Zhang Y,Siefers N,Holt BF NF-YC3, NF-YC4 and NF-YC9 are required for CONSTANS-mediated, photoperiod-dependent flowering in Arabidopsis thaliana. Plant J., 2010. 63(3): p. 379-91 [PMID:20487380] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Liang M,Hole D,Wu J,Blake T,Wu Y Expression and functional analysis of NUCLEAR FACTOR-Y, subunit B genes in barley. Planta, 2012. 235(4): p. 779-91 [PMID:22042327] Hackenberg D, et al. Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y. Mol Plant, 2012. 5(4): p. 876-88 [PMID:22199235] Calvenzani V, et al. Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits. PLoS ONE, 2012. 7(8): p. e42902 [PMID:22912760] Zhang ZW, et al. The roles of two transcription factors, ABI4 and CBFA, in ABA and plastid signalling and stress responses. Plant Mol. Biol., 2013. 83(4-5): p. 445-58 [PMID:23832569] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hou X, et al. Nuclear factor Y-mediated H3K27me3 demethylation of the SOC1 locus orchestrates flowering responses of Arabidopsis. Nat Commun, 2014. 5: p. 4601 [PMID:25105952] Sato H, et al. Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits. Plant Cell, 2014. 26(12): p. 4954-73 [PMID:25490919] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]