PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G61120.1 | ||||||||
Common Name | AGL13, T20K12.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 27967.6 Da PI: 6.9175 | ||||||||
Description | AGAMOUS-like 13 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.2 | 1.2e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+ rqvtfskR+ g+lKKA+ELSvLCdaev++iifs+ gklye+s+ AT3G61120.1 9 KRIENKITRQVTFSKRKSGLLKKAYELSVLCDAEVSLIIFSTGGKLYEFSN 59 79***********************************************95 PP | |||||||
2 | K-box | 87.9 | 2e-29 | 82 | 169 | 11 | 98 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++++ l+qe++kLk ++e+L r++R+l+GedLe +s+keLq Le+qLe +l+ R++K+++++eq+eel++ke+el ++n++L+ + AT3G61120.1 82 LEDTQGLRQEVTKLKCKYESLLRTHRNLVGEDLEGMSIKELQTLERQLEGALSATRKQKTQVMMEQMEELRRKERELGDINNKLKLET 169 567899******************************************************************************9765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.127 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.9E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.85E-40 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 3.79E-31 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.8E-25 | 84 | 168 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.459 | 85 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009555 | Biological Process | pollen development | ||||
GO:0010468 | Biological Process | regulation of gene expression | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0009005 | anatomy | root | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MGRGKVEVKR IENKITRQVT FSKRKSGLLK KAYELSVLCD AEVSLIIFST GGKLYEFSNV 60 GVGRTIERYY RCKDNLLDND TLEDTQGLRQ EVTKLKCKYE SLLRTHRNLV GEDLEGMSIK 120 ELQTLERQLE GALSATRKQK TQVMMEQMEE LRRKERELGD INNKLKLETE DHDFKGFQDL 180 LLNPVLTAGC STDFSLQSTH QNYISDCNLG YFLQIGFQQH YEQGEGSSVT KSNARSDAET 240 NFVQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 18411849 | 0.0 | ||||
Genevisible | 251312_at | 0.0 | ||||
Expression Atlas | AT3G61120 | - | ||||
AtGenExpress | AT3G61120 | - | ||||
ATTED-II | AT3G61120 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00417 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G61120.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT4G18960, AT4G37940, AT1G48150 | |||||
IntAct | Search Q38837 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G61120 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | ATU20183 | 0.0 | U20183.1 Arabidopsis thaliana MADS-box protein AGL13 (AGL13) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_191671.1 | 1e-179 | AGAMOUS-like 13 | ||||
Swissprot | Q38837 | 1e-180 | AGL13_ARATH; Agamous-like MADS-box protein AGL13 | ||||
TrEMBL | D7LS60 | 1e-164 | D7LS60_ARALL; Uncharacterized protein | ||||
STRING | AT3G61120.1 | 1e-178 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4302 | 26 | 54 | Representative plant | OGRP16 | 17 | 761 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G61120.1 |
Entrez Gene | 825284 |
iHOP | AT3G61120 |
wikigenes | AT3G61120 |