PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G45170.1 | ||||||||
Common Name | GATA14, T14D3.110 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 204aa MW: 23175 Da PI: 9.9747 | ||||||||
Description | GATA transcription factor 14 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57.4 | 1.9e-18 | 117 | 151 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 Cs+Cgt kTplWR+gp+g tLCnaCG++yr +l AT3G45170.1 117 CSHCGTRKTPLWREGPRGAGTLCNACGMRYRTGRL 151 *******************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.624 | 111 | 147 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.4E-15 | 111 | 161 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 3.94E-15 | 114 | 173 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 3.2E-15 | 115 | 149 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.24E-18 | 116 | 165 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 117 | 142 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 2.5E-16 | 117 | 151 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MSGREDEEED LGTAMQKIPI PVNVFDKEPM DLDTVFGFAD GVREIIEDSN LLLEESREFD 60 TNDSKPSRNF SNLPTATRGR LHAPKRSGNK RGRQKRLSFK SPSDLFDSKF GITDKSCSHC 120 GTRKTPLWRE GPRGAGTLCN ACGMRYRTGR LLPEYRPASS PDFKPNVHSN FHRKVMEIRR 180 ERKSSPPNSF GFSESYHSTR KLGF |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | AT3G45170 | |||||
AtGenExpress | AT3G45170 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a member of the GATA factor family of zinc finger transcription factors. | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00391 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G45170.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G45170 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AL138649 | 0.0 | AL138649.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T14D3. | |||
GenBank | CP002686 | 0.0 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_190103.1 | 1e-150 | GATA transcription factor 14 | ||||
Swissprot | Q9M1U2 | 1e-151 | GAT14_ARATH; GATA transcription factor 14 | ||||
TrEMBL | A0A178VIJ2 | 1e-133 | A0A178VIJ2_ARATH; GATA14 | ||||
STRING | AT3G45170.1 | 1e-149 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16368 | 11 | 13 | Representative plant | OGRP68 | 17 | 287 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G45170.1 |
Entrez Gene | 823653 |
iHOP | AT3G45170 |
wikigenes | AT3G45170 |