Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | G2-like | 88.6 | 5.6e-28 | 171 | 223 | 3 | 56 |
G2-like 3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
+++WtpeLH+rFveaveqL G +kA+P++ilelm+v++Lt+++v+SHLQkYR++
AT2G20570.2 171 KVDWTPELHRRFVEAVEQL-GVDKAVPSRILELMGVHCLTRHNVASHLQKYRSH 223
689****************.********************************86 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
TAIR | Encodes GLK1, Golden2-like 1, one of a pair of partially redundant nuclear transcription factors that regulate chloroplast development in a cell-autonomous manner. GLK2, Golden2-like 2, is encoded by At5g44190. GLK1 and GLK2 regulate the expression of the photosynthetic apparatus. |
UniProt | Transcriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}. |
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Tamai H,Iwabuchi M,Meshi T
Arabidopsis GARP transcriptional activators interact with the Pro-rich activation domain shared by G-box-binding bZIP factors. Plant Cell Physiol., 2002. 43(1): p. 99-107 [PMID:11828027] - Fitter DW,Martin DJ,Copley MJ,Scotland RW,Langdale JA
GLK gene pairs regulate chloroplast development in diverse plant species. Plant J., 2002. 31(6): p. 713-27 [PMID:12220263] - Savitch LV,Subramaniam R,Allard GC,Singh J
The GLK1 'regulon' encodes disease defense related proteins and confers resistance to Fusarium graminearum in Arabidopsis. Biochem. Biophys. Res. Commun., 2007. 359(2): p. 234-8 [PMID:17533111] - GutiƩrrez RA, et al.
Systems approach identifies an organic nitrogen-responsive gene network that is regulated by the master clock control gene CCA1. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(12): p. 4939-44 [PMID:18344319] - Waters MT,Moylan EC,Langdale JA
GLK transcription factors regulate chloroplast development in a cell-autonomous manner. Plant J., 2008. 56(3): p. 432-44 [PMID:18643989] - Waters MT, et al.
GLK transcription factors coordinate expression of the photosynthetic apparatus in Arabidopsis. Plant Cell, 2009. 21(4): p. 1109-28 [PMID:19376934] - Bravo-Garcia A,Yasumura Y,Langdale JA
Specialization of the Golden2-like regulatory pathway during land plant evolution. New Phytol., 2009. 183(1): p. 133-41 [PMID:19383092] - Kakizaki T, et al.
Coordination of plastid protein import and nuclear gene expression by plastid-to-nucleus retrograde signaling. Plant Physiol., 2009. 151(3): p. 1339-53 [PMID:19726569] - Perochon A, et al.
Interaction of a plant pseudo-response regulator with a calmodulin-like protein. Biochem. Biophys. Res. Commun., 2010. 398(4): p. 747-51 [PMID:20627089] - Yu X, et al.
A brassinosteroid transcriptional network revealed by genome-wide identification of BESI target genes in Arabidopsis thaliana. Plant J., 2011. 65(4): p. 634-46 [PMID:21214652] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] - Yu B, et al.
Arabidopsis cpSRP54 regulates carotenoid accumulation in Arabidopsis and Brassica napus. J. Exp. Bot., 2012. 63(14): p. 5189-202 [PMID:22791829] - Wang P, et al.
Evolution of GOLDEN2-LIKE gene function in C(3) and C (4) plants. Planta, 2013. 237(2): p. 481-95 [PMID:22968911] - Efroni I, et al.
Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] - Rauf M, et al.
ORE1 balances leaf senescence against maintenance by antagonizing G2-like-mediated transcription. EMBO Rep., 2013. 14(4): p. 382-8 [PMID:23459204] - Kobayashi K, et al.
Photosynthesis of root chloroplasts developed in Arabidopsis lines overexpressing GOLDEN2-LIKE transcription factors. Plant Cell Physiol., 2013. 54(8): p. 1365-77 [PMID:23749810] - Murmu J, et al.
Arabidopsis GOLDEN2-LIKE (GLK) transcription factors activate jasmonic acid (JA)-dependent disease susceptibility to the biotrophic pathogen Hyaloperonospora arabidopsidis, as well as JA-independent plant immunity against the necrotrophic pathogen Botrytis cinerea. Mol. Plant Pathol., 2014. 15(2): p. 174-84 [PMID:24393452] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Leister D,Kleine T
Definition of a core module for the nuclear retrograde response to altered organellar gene expression identifies GLK overexpressors as gun mutants. Physiol Plant, 2016. 157(3): p. 297-309 [PMID:26876646] - Nagatoshi Y, et al.
GOLDEN 2-LIKE transcription factors for chloroplast development affect ozone tolerance through the regulation of stomatal movement. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(15): p. 4218-23 [PMID:27035938] - Tokumaru M, et al.
Ubiquitin-Proteasome Dependent Regulation of the GOLDEN2-LIKE 1 Transcription Factor in Response to Plastid Signals. Plant Physiol., 2017. 173(1): p. 524-535 [PMID:27821720] - Ni F, et al.
Turnip Yellow Mosaic Virus P69 Interacts with and Suppresses GLK Transcription Factors to Cause Pale-Green Symptoms in Arabidopsis. Mol Plant, 2017. 10(5): p. 764-766 [PMID:27964999] - Wang H,Seo JK,Gao S,Cui X,Jin H
Silencing of AtRAP, a target gene of a bacteria-induced small RNA, triggers antibacterial defense responses through activation of LSU2 and down-regulation of GLK1. New Phytol., 2017. 215(3): p. 1144-1155 [PMID:28656601]
|