PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA75G00035 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 146aa MW: 17372.7 Da PI: 5.3832 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 101.5 | 1.2e-31 | 17 | 136 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 lppGfrF+P de+lv eyL+kkv ++++ ++e++ ++++PwdL +++ke+yfF+k+++ + rk++ t+sgyW++ +++ v+++ ++ AA75G00035 17 LPPGFRFDPDDEDLVFEYLAKKVLYLPMDF--DLPELRSCNADPWDLL---GEKNKEVYFFVKKEEME----RKRKETSSGYWEECEEEE-VMHQanGR 105 79*************************999..49*************6...56789*******99875....888999******987755.55543555 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 g +kt +fy gr+p+g+ t W+m e+rl AA75G00035 106 GFEGRRKTYAFYIGRKPRGTITPWIMYEFRL 136 569**************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.5E-34 | 6 | 141 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 33.424 | 17 | 146 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-19 | 18 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MDISTQRFAM NGRSMKLPPG FRFDPDDEDL VFEYLAKKVL YLPMDFDLPE LRSCNADPWD 60 LLGEKNKEVY FFVKKEEMER KRKETSSGYW EECEEEEVMH QANGRGFEGR RKTYAFYIGR 120 KPRGTITPWI MYEFRLLSSS ISQVSH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 7e-19 | 15 | 140 | 15 | 146 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 7e-19 | 15 | 140 | 15 | 146 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 7e-19 | 15 | 140 | 15 | 146 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 7e-19 | 15 | 140 | 15 | 146 | NO APICAL MERISTEM PROTEIN |
3swm_A | 9e-19 | 15 | 140 | 18 | 149 | NAC domain-containing protein 19 |
3swm_B | 9e-19 | 15 | 140 | 18 | 149 | NAC domain-containing protein 19 |
3swm_C | 9e-19 | 15 | 140 | 18 | 149 | NAC domain-containing protein 19 |
3swm_D | 9e-19 | 15 | 140 | 18 | 149 | NAC domain-containing protein 19 |
3swp_A | 9e-19 | 15 | 140 | 18 | 149 | NAC domain-containing protein 19 |
3swp_B | 9e-19 | 15 | 140 | 18 | 149 | NAC domain-containing protein 19 |
3swp_C | 9e-19 | 15 | 140 | 18 | 149 | NAC domain-containing protein 19 |
3swp_D | 9e-19 | 15 | 140 | 18 | 149 | NAC domain-containing protein 19 |
4dul_A | 7e-19 | 15 | 140 | 15 | 146 | NAC domain-containing protein 19 |
4dul_B | 7e-19 | 15 | 140 | 15 | 146 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA75G00035 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006402058.1 | 5e-75 | NAC domain-containing protein 41 | ||||
TrEMBL | A0A1J3H2V2 | 2e-75 | A0A1J3H2V2_NOCCA; NAC domain-containing protein 55 (Fragment) | ||||
STRING | XP_006402058.1 | 2e-74 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14666 | 18 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50820.1 | 4e-71 | NAC domain containing protein 97 |