PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678413623 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 83aa MW: 9442.83 Da PI: 10.1207 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 54.2 | 2e-17 | 37 | 66 | 1 | 30 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyy 30 C++Cgt +TplWR+gpdg tLCnaCGl++ 678413623 37 CRHCGTVDTPLWRKGPDGRQTLCNACGLKH 66 ****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 7.13E-14 | 29 | 71 | No hit | No description |
SMART | SM00401 | 2.6E-10 | 31 | 83 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 13.455 | 31 | 66 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 7.3E-16 | 35 | 68 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 4.21E-12 | 36 | 82 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 37 | 62 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 4.1E-15 | 37 | 66 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MSTYAGAYNF ITAAARHNYF VSMSPMMRRN PDDMRICRHC GTVDTPLWRK GPDGRQTLCN 60 ACGLKHLRSA KKDTAESAYK RKD |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678413623 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011080229.1 | 1e-17 | GATA transcription factor 15-like | ||||
Swissprot | Q54TM6 | 5e-14 | GTAI_DICDI; GATA zinc finger domain-containing protein 9 | ||||
TrEMBL | S8CSV2 | 2e-17 | S8CSV2_9LAMI; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA16673 | 5 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28340.1 | 2e-11 | GATA transcription factor 13 |